Partitioning Residue Identity in Somatic Maturation
This is the official repository for the paper:
Explicit representation of germline and non-germline residues improves antibody language modeling
PRISM is a PyTorch Lightning-based framework for supervised fine-tuning of ESM2 protein language models on antibody sequences. It features a multi-head architecture that jointly learns amino acid identity prediction and germline/non-germline (GL/NGL) position classification.
- Model weights: RomeroLab-Duke/prism-antibody
- Training data: RomeroLab-Duke/prism-antibody-data — curated unpaired & paired OAS antibody sequences plus the exact download manifest used to build them.
Everything you need to run inference with PRISM on your own antibody data.
pip install prism-antibodyOr install from source:
git clone https://github.com/RomeroLab-Duke/prism-antibody.git
cd prism-antibody
pip install -e .import prism
print(prism.__version__)import prism
model = prism.pretrained("RomeroLab-Duke/prism-antibody")
tokenizer = model.get_tokenizer()
# Tokenize → model (standard HuggingFace-style pipeline)
inputs = tokenizer("EVQLVESGGGLVQ", light_chain="DIQMTQSPSSLSA", return_tensors="pt")
# Forward pass — logits, embeddings, origin, alpha
result = model.forward(input_ids=inputs["input_ids"], attention_mask=inputs["attention_mask"])
# Predict germline — revert somatic mutations
germline = model.predict_germline(input_ids=inputs["input_ids"], attention_mask=inputs["attention_mask"])
# germline["heavy"]["predicted_germline"] → germline-reverted heavy chain
# germline["heavy"]["ngl_positions"] → which positions were mutatedPrismTokenizer wraps the ESM2 tokenizer with PRISM's 53-token vocabulary (33 ESM2 base + 20 lowercase NGL tokens).
tokenizer = prism.PrismTokenizer() # standalone (no model needed)
tokenizer = model.get_tokenizer() # or from a loaded model
# Paired heavy + light chain
inputs = tokenizer("EVQLVESGGGLVQ", light_chain="DIQMTQSPSSLSA", return_tensors="pt")
# inputs["input_ids"] -> [1, L_H+L_L+4] (CLS + VH + CLS + CLS + VL + EOS)
# inputs["attention_mask"] -> [1, L_H+L_L+4]
# Batch
inputs = tokenizer(
["EVQLVESGGGLVQ", "QVQLVQSGAEVKK"],
light_chain=["DIQMTQSPSSLSA", "EIVLTQSPGTLSL"],
return_tensors="pt",
)
# Unpaired (single chain)
inputs = tokenizer("EVQLVESGGGLVQ", return_tensors="pt")
# Encode / decode (paired)
ids = tokenizer.encode_paired("EVQLV", "DIQMT")
heavy, light = tokenizer.decode_paired(ids) # ("EVQLV", "DIQMT")
# Encode / decode (unpaired)
ids = tokenizer.encode("EVQLV") # [CLS, E, V, Q, L, V, EOS]
seq = tokenizer.decode(ids) # "EVQLV"By default, all amino acids are tokenized as uppercase (GL) tokens — this is the standard mode and matches the training format. Use preserve_case=True only when you need exact mode in pseudo_log_likelihood(), which scores each position using its actual GL or NGL log-probability.
# For exact PLL: lowercase = NGL (somatic mutation) positions
inputs = tokenizer("EvQLvESGGglvq", preserve_case=True, return_tensors="pt")
# 'v', 'g', 'l', 'v' → NGL token IDs; 'E', 'Q', 'L', ... → GL token IDs
result = model.pseudo_log_likelihood(
input_ids=inputs["input_ids"],
attention_mask=inputs["attention_mask"],
)
# result["exact"] now uses NGL log-prob at lowercase positionstokenizer.gl_token_ids # {"A": 5, "C": 23, ...} — 20 uppercase (germline)
tokenizer.ngl_token_ids # {"a": 33, "c": 34, ...} — 20 lowercase (non-germline)
tokenizer.gl_to_ngl # {5: 33, 23: 34, ...} — GL→NGL token ID mapping
tokenizer.vocab_size # 53PRISM has 5 core methods. All accept pre-tokenized input_ids (recommended) or raw strings.
| Method | Cost | Returns |
|---|---|---|
forward() |
1 forward pass | logits, embeddings, origin, alpha |
pseudo_log_likelihood() |
ceil(L / batch_size) forward passes | PLL, perplexity, per-position log-probs (4 modes) |
score_mutations() |
2 × ceil(M / batch_size) forward passes | masked marginal mutation scores (4 modes) |
predict_germline() |
1 forward pass | predicted germline sequences, NGL positions/probs |
generate() |
L + N forward passes | PLL-guided antibody variants |
Single forward pass through the model. Returns all outputs as numpy arrays.
import prism
import numpy as np
model = prism.pretrained("RomeroLab-Duke/prism-antibody")
tokenizer = model.get_tokenizer()
# Standard: tokenize → forward (paired)
inputs = tokenizer("EVQLVESGGGLVQ", light_chain="DIQMTQSPSSLSA", return_tensors="pt")
result = model.forward(input_ids=inputs["input_ids"], attention_mask=inputs["attention_mask"])
# result["final_logits"] -> [L, 53] alpha-gated combined logits
# result["aa_logits"] -> [L, 33] AA head logits (pre-gating)
# result["origin_logits"] -> [L] GL/NGL classification logits
# result["alpha"] -> [L] gating values
# result["embedding"] -> [L, H] per-residue hidden states
# GL/NGL log-probabilities (slice from 53-vocab)
gl_logits = result["final_logits"][:, model.GL_INDICES] # [L, 20]
ngl_logits = result["final_logits"][:, model.NGL_INDICES] # [L, 20]# Batch (returns list of {"heavy": {...}, "light": {...}})
results = model.forward(
heavy_chains=["EVQLVESGGGLVQ", "QVQLVQSGAEVKK"],
light_chains=["DIQMTQSPSSLSA", "EIVLTQSPGTLSL"],
)
# String convenience (paired)
result = model.forward(heavy_chains="EVQLVESGGGLVQ", light_chains="DIQMTQSPSSLSA")
# Unpaired (single chain)
result = model.forward("EVQLVESGGGLVQPGGSLRL")Masks each position one at a time, accumulates log P(true token). Returns 4 scoring modes in one pass.
# Standard: tokenize → PLL
inputs = tokenizer("EVQLVESGGGLVQ", light_chain="DIQMTQSPSSLSA", return_tensors="pt")
result = model.pseudo_log_likelihood(
input_ids=inputs["input_ids"],
attention_mask=inputs["attention_mask"],
)
# {
# "marginalized": {"pll": -45.3, "perplexity": 2.34, "per_position": [L]},
# "gl": {"pll": -50.1, "perplexity": 2.71, "per_position": [L]},
# "ngl": {"pll": -48.2, "perplexity": 2.56, "per_position": [L]},
# "exact": {"pll": -50.1, "perplexity": 2.71, "per_position": [L]},
# }
ppl = result["marginalized"]["perplexity"]When the input contains NGL tokens (lowercase via preserve_case=True --- see NGL-Aware Tokenization), the exact mode scores each position using its actual token: uppercase log-prob for GL positions, lowercase log-prob for NGL positions.
All modes are computed from the 53-vocab alpha-gated logits. gl, ngl, and marginalized extract the GL/NGL slots and combine them back into 20-AA probabilities.
| Mode | What it scores | Use case |
|---|---|---|
marginalized |
logsumexp(GL, NGL) per AA |
General-purpose scoring |
gl |
Uppercase (GL) token log-prob | Germline likeness |
ngl |
Lowercase (NGL) token log-prob | Somatic mutation preference |
exact |
Actual input token log-prob | NGL-aware scoring (with preserve_case=True) |
batch_size controls how many masked positions are processed in a single forward pass. Higher values use more GPU memory but run faster.
# Fast: 64 positions per forward pass (needs ~2x memory vs default)
result = model.pseudo_log_likelihood(
input_ids=inputs["input_ids"],
attention_mask=inputs["attention_mask"],
batch_size=64,
)For multiple sequences, pass a list --- they are scored sequentially, each with the same batch_size parallelism:
# Multiple sequences (processed one at a time, results in order)
results = model.pseudo_log_likelihood(
heavy_chains=["EVQLVESGGGLVQ", "QVQLVQSGAEVKK"],
light_chains=["DIQMTQSPSSLSA", "EIVLTQSPGTLSL"],
)
# results[0] → first pair, results[1] → second pair# Paired
result = model.pseudo_log_likelihood(
heavy_chains="EVQLVESGGGLVQ",
light_chains="DIQMTQSPSSLSA",
)
# Unpaired
result = model.pseudo_log_likelihood("EVQLVESGGGLVQPGGSLRL")Masked marginal scoring at mutation positions. For each mutated position, masks that position in both WT and mutant, runs a forward pass, and computes the log-likelihood difference. Returns all 4 scoring modes.
# Standard: tokenize → score (paired)
wt_inputs = tokenizer("EVQLVESGGGLVQPGGSLRL", light_chain="DIQMTQSPSSLSA", return_tensors="pt")
mut_inputs = tokenizer("EVQLVASGGGLVQPGGSLRL", light_chain="DIQMTQSPSSLSA", return_tensors="pt") # V6A
result = model.score_mutations(
wt_input_ids=wt_inputs["input_ids"],
mut_input_ids=mut_inputs["input_ids"],
)
# {
# "positions": [5], # 0-indexed mutation positions (detected from token diff)
# "marginalized": {"score": 0.42, "per_position": [1]},
# "gl": {"score": 0.31, "per_position": [1]},
# "ngl": {"score": 0.55, "per_position": [1]},
# "exact": {"score": 0.31, "per_position": [1]},
# }
# score > 0 = mutant preferred over WTbatch_size controls how many mutation positions are masked per forward pass. For sequences with many mutations, higher values are faster.
result = model.score_mutations(
wt_input_ids=wt_inputs["input_ids"],
mut_input_ids=mut_inputs["input_ids"],
batch_size=64,
)For multiple WT/mutant pairs, pass lists --- they are scored sequentially:
results = model.score_mutations(
wt=["EVQLVESGGGLVQ", "QVQLVQSGAEVKK"],
mutant=["EVQLVASGGGLVQ", "QVQLVQSGAEVAK"],
wt_light_chains=["DIQMTQSPSSLSA", "EIVLTQSPGTLSL"],
mut_light_chains=["DIQMTQSPSSLSA", "EIVLTQSPGTLSL"],
)
# results[0] → first pair, results[1] → second pair# Paired
result = model.score_mutations(
wt="EVQLVESGGGLVQPGGSLRL",
mutant="EVQLVASGGGLVQPGGSLRL",
wt_light_chains="DIQMTQSPSSLSA",
mut_light_chains="DIQMTQSPSSLSA",
)
# Unpaired
result = model.score_mutations(
wt="EVQLVESGGGLVQPGGSLRL",
mutant="EVQLVASGGGLVQPGGSLRL",
)Predicts the unmutated germline sequence from a somatically hypermutated antibody. Uses the origin head to identify non-germline (NGL) positions and reverts them to the top-scoring germline amino acid --- all in a single forward pass.
import prism
model = prism.pretrained("RomeroLab-Duke/prism-antibody")
tokenizer = model.get_tokenizer()
# Standard: tokenize → predict germline (paired)
inputs = tokenizer("EVQLVESGGGLVQ", light_chain="DIQMTQSPSSLSA", return_tensors="pt")
result = model.predict_germline(
input_ids=inputs["input_ids"],
attention_mask=inputs["attention_mask"],
)
# {
# "heavy": {
# "sequence": "EVQLVESGGGLVQ", # original
# "predicted_germline": "EVQLVESGGGLVQ", # germline-reverted
# "ngl_positions": [5, 8], # 0-indexed NGL positions
# "ngl_count": 2,
# "ngl_probs": array([0.02, ..., 0.91, ..., 0.87, ...]), # [L_H] P(NGL)
# },
# "light": { ... same structure ... },
# }- Origin head classifies each position as GL or NGL via
sigmoid(origin_logits). - Positions with
P(NGL) > ngl_thresholdare identified as somatically mutated. - At those positions, the residue is replaced with
argmaxover the 20 GL amino acid logits from the final head. - GL positions are left unchanged.
When using pre-tokenized input_ids, paired sequences are automatically detected by finding the <cls><cls> separator in the token IDs --- no additional parameters needed:
# Paired: auto-detected from <cls><cls> in input_ids
inputs = tokenizer("EVQLVESGGGLVQ", light_chain="DIQMTQSPSSLSA", return_tensors="pt")
result = model.predict_germline(input_ids=inputs["input_ids"])
# → result["heavy"], result["light"]
# Unpaired: no <cls><cls> → flat output
inputs = tokenizer("EVQLVESGGGLVQ", return_tensors="pt")
result = model.predict_germline(input_ids=inputs["input_ids"])
# → result["sequence"], result["predicted_germline"], ...# Aggressive: revert more positions (lower threshold)
result = model.predict_germline(
input_ids=inputs["input_ids"],
ngl_threshold=0.3,
)
# Conservative: only revert high-confidence NGL positions
result = model.predict_germline(
input_ids=inputs["input_ids"],
ngl_threshold=0.8,
)inputs = tokenizer(
["EVQLVESGGGLVQ", "QVQLVQSGAEVKK"],
light_chain=["DIQMTQSPSSLSA", "EIVLTQSPGTLSL"],
return_tensors="pt",
)
results = model.predict_germline(
input_ids=inputs["input_ids"],
attention_mask=inputs["attention_mask"],
)
# results[0] → first pair, results[1] → second pair# Paired
result = model.predict_germline(
heavy_chains="EVQLVESGGGLVQ",
light_chains="DIQMTQSPSSLSA",
)
# Unpaired
result = model.predict_germline(heavy_chains="EVQLVESGGGLVQ")Generates antibody variants using pseudo-log-likelihood guided sampling:
- Collect --- mask each position one at a time, collect pre-gating logits (L forward passes, cached and reusable)
- Select positions --- rank by WT log-probability, sample via Gumbel-Top-k with controllable temperature
- Sample amino acids --- draw from GL, NGL, marginalized, or region-specific logits with temperature, top-k, and nucleus sampling
# Standard: tokenize → generate
inputs = tokenizer(
"EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMS",
light_chain="DIQMTQSPSSLSASVGDRVTITCRASQSISSYLN",
return_tensors="pt",
)
variants = model.generate(
input_ids=inputs["input_ids"],
attention_mask=inputs["attention_mask"],
n_samples=100, # number of variants to generate
n_mutations=5, # mutations per variant
mode="full", # gl | ngl | full | region_specific
seed=42,
)
# List of 100 dicts:
# [
# {"sequence": "EVQLVE...", "mutations": "S7A,G10D,...", "positions": [6, 9, ...],
# "mode": "full", "n_mut": 5},
# ...
# ]| Mode | Position scoring | AA sampling | Use case |
|---|---|---|---|
"full" |
Marginalized log P(wt) | logsumexp(GL, NGL) logits |
General-purpose diversification |
"gl" |
GL log P(wt) | GL (germline) logits only | Germline reversion / humanization |
"ngl" |
NGL log P(wt) | NGL (non-germline) logits only | Affinity maturation mimicry |
"region_specific" |
FR: GL, CDR: NGL | FR: GL logits, CDR: NGL logits | Targeted: conserve FRs, diversify CDRs |
variants = model.generate(
input_ids=inputs["input_ids"],
attention_mask=inputs["attention_mask"],
n_samples=100,
n_mutations=5,
# --- Position selection ---
pool_size=30, # candidate pool (top-30 worst positions)
position_temperature=0.5, # lower = more deterministic position choice
exclude_positions=np.array([0, 1, 2]), # never mutate these (0-indexed)
# --- Amino acid sampling ---
temperature=0.8, # lower = more conservative AA choices
top_k=10, # only consider top-10 AAs per position
top_p=0.9, # nucleus sampling threshold
# --- Variation ---
randomize_n_mutations=True, # n_mut ~ Beta(2,1) in [1, n_mutations]
seed=42, # reproducibility
)The "region_specific" mode uses framework region (FR) and complementarity-determining region (CDR) annotations to apply different sampling strategies: GL logits for FR positions (conserve structure) and NGL logits for CDR positions (diversify binding).
Regions are auto-detected using ANARCI (IMGT numbering). Pass heavy_chain_length so VH and VL are numbered separately:
variants = model.generate(
input_ids=inputs["input_ids"],
attention_mask=inputs["attention_mask"],
n_samples=100,
n_mutations=5,
mode="region_specific",
heavy_chain_length=len("EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMS"),
)Or provide region labels manually (0 = FR, 1 = CDR):
import numpy as np
L = len(vh_seq) + len(vl_seq)
region_labels = np.zeros(L, dtype=np.int32)
region_labels[26:34] = 1 # CDR1
region_labels[51:57] = 1 # CDR2
region_labels[93:102] = 1 # CDR3
# ... repeat for VL
variants = model.generate(
input_ids=inputs["input_ids"],
attention_mask=inputs["attention_mask"],
n_samples=100,
n_mutations=5,
mode="region_specific",
region_labels=region_labels,
)The most expensive step (L forward passes) can be computed once and reused across different modes:
# First call: collect masked logits + generate
variants_full, cache = model.generate(
input_ids=inputs["input_ids"],
attention_mask=inputs["attention_mask"],
n_samples=100, n_mutations=5, mode="full", seed=42,
return_masked_data=True,
)
# Subsequent calls: skip L forward passes (instant)
variants_gl = model.generate(
input_ids=inputs["input_ids"],
attention_mask=inputs["attention_mask"],
n_samples=100, n_mutations=5, mode="gl", seed=42,
masked_data=cache,
)
variants_ngl = model.generate(
input_ids=inputs["input_ids"],
attention_mask=inputs["attention_mask"],
n_samples=100, n_mutations=5, mode="ngl", seed=42,
masked_data=cache,
)variants = model.generate(
heavy_chains="EVQLVESGGGLVQPGGSLRLSCAASGFTFSSYAMS",
light_chains="DIQMTQSPSSLSASVGDRVTITCRASQSISSYLN",
n_samples=100, n_mutations=5, mode="full", seed=42,
)| Key | Shape | Description |
|---|---|---|
final_logits |
[L, 53] |
Alpha-gated combined logits (53-vocab) |
aa_logits |
[L, 33] |
AA head logits, before gating |
origin_logits |
[L] |
GL/NGL binary classification logits |
alpha |
[L] |
Per-position gating values |
embedding |
[L, H] |
Per-residue hidden states from backbone |
When paired (string API or auto-detected <cls><cls>), returns {"heavy": {dict}, "light": {dict}}.
| Key | Type | Description |
|---|---|---|
sequence |
str |
Original amino acid sequence |
predicted_germline |
str |
Germline-reverted sequence (NGL positions replaced) |
ngl_positions |
list[int] |
0-indexed positions classified as NGL |
ngl_count |
int |
Number of NGL positions |
ngl_probs |
[L] numpy array |
Per-position P(NGL) from origin head |
When paired, returns {"heavy": {dict}, "light": {dict}} with per-chain values.
model.GL_INDICES--- 20 uppercase AA token indices in the 53-vocabmodel.NGL_INDICES--- 20 lowercase AA token indices in the 53-vocabmodel.AA_ORDER = "ACDEFGHIKLMNPQRSTVWY"--- column order for the 20 AA indices
For researchers and developers who want to train from scratch, run analysis pipelines, or extend the codebase.
git clone https://github.com/RomeroLab-Duke/prism-antibody.git
cd prism-antibody
pip install -e ".[dev,analysis]"prism/
├── src/prism/ # Core Python package
│ ├── api.py # High-level inference API
│ ├── tokenizer.py # PrismTokenizer (53-vocab, paired support)
│ ├── model.py # SFT_ESM2 PyTorch Lightning module
│ ├── io_utils.py # Dataset & DataModule classes
│ ├── multimodal_io.py # Gene vocabulary & antibody dataset
│ └── utils.py # Utility functions
│
├── configs/ # YAMLs to reproduce paper results
│ ├── v34_pretrain.yaml # canonical pretrain
│ ├── v34_1b_finetune.yaml # canonical paper model
│ ├── v34_1b_noise{2,4}_finetune.yaml # noise-robustness ablation
│ ├── v_baseline_{pre,fine}tune.yaml # PRISM-less baseline
│ ├── ablation_{alpha_*,no_pretrain,simple_*}.yaml # architectural ablations
│ └── pll_guided_sampler.yaml # generation sampler
│
├── script/
│ ├── train_esm.py # PRISM trainer
│ ├── train_pure_esm.py # vanilla-ESM2 baseline trainer
│ ├── inference_esm.py # forward + embeddings
│ ├── inference_pure_esm_with_logprobs.py # vanilla-ESM2 baseline scorer
│ ├── data/ # OAS preprocessing pipeline (1-8)
│ └── analyze/ # paper-section ordered analyses
│ ├── 1.disentanglement/ # Fig. 2A-C: linear probing + UMAP
│ ├── 2.pseudo_perplexity/ # Fig. 2D-G + SI 2: PPL stratified
│ ├── 3.controllable_generation/ # Fig. 3 + SI 4-5: Rosetta/MLP/CamSol
│ ├── 4.zero_shot_binding/ # Fig. 4: DMS + FLAb2 binding
│ ├── 5.zero_shot_developability/ # Fig. 5: developability assays
│ ├── 6.ablation/ # Fig. 6 + SI 8-12: arch + alpha + noise
│ └── 7.thera_sabdab/ # SI 17: therapeutic generalization
│
├── pyproject.toml # Package configuration
├── LICENSE # MIT
└── CITATION.cff # Paper citation
Stage 1 --- Pretraining on large unpaired OAS dataset (~60M+ sequences):
python script/train_esm.py --config configs/v34_pretrain.yamlStage 2 --- Finetuning on paired antibody sequences (~764K):
python script/train_esm.py --config configs/v34_1b_finetune.yamlCUDA_VISIBLE_DEVICES=0,1,2,3 python script/train_esm.py --config configs/v34_pretrain.yamlEdit data_path, gene_vocab_path, etc. in the configs from the /path/to/prism/... placeholder to the location where you downloaded the OAS data.
Each paper figure maps to a numbered subdirectory under script/analyze/:
| Paper section | Figure | Script directory |
|---|---|---|
| Disentanglement | Fig. 2A-C, SI 10 | script/analyze/1.disentanglement/ |
| Pseudo-perplexity | Fig. 2D-G, SI 2 | script/analyze/2.pseudo_perplexity/ |
| Controllable generation | Fig. 3, SI 4-5, 13, 16 | script/analyze/3.controllable_generation/ |
| Zero-shot binding | Fig. 4 | script/analyze/4.zero_shot_binding/ |
| Zero-shot developability | Fig. 5, SI 3, 6 | script/analyze/5.zero_shot_developability/ |
| Ablation + α-gating + noise | Fig. 6, SI 8-12 | script/analyze/6.ablation/ |
| Therapeutic generalization | SI 17 | script/analyze/7.thera_sabdab/ |
PRISM's figures compare against five baseline language models. Scoring scripts live alongside the PRISM-side scripts in each analyze/N.*/ directory:
- IgLM, AntiBerty:
4.zero_shot_binding/iglm/,5.zero_shot_developability/iglm/,7.thera_sabdab/score_therasabdab_w_iglm.py(shared utilities atscript/analyze/utils/). - ESM2-35M, ESM2-650M, AbLang2, Sapiens: scored via the corresponding
evaluate_*_baselines.py/benchmark_*_baselines.pyfiles in4.zero_shot_binding/and5.zero_shot_developability/.
The "MLP" scoring axis of Fig. 3 is a Ridge regressor trained on each antibody's DMS labels (paper line 913). Trainer at 3.controllable_generation/train_dms_surrogate.py; pre-trained weights for the three Fig. 3 antibodies at 3.controllable_generation/dms_surrogates/{cr9114,g631,trastuzumab}_ridge.joblib.
CamSol scores (Fig. 3) are produced by the CamSol web server at pH 7.0; the local pipeline reads back the server outputs from data/.
MIT License --- see LICENSE for details.