Update project files (#15) Generated by v0 [v0 Session](https://v0.app/chat/2tqoPgihDyU)#21
Conversation
…ct-setup Stabilize RKix project setup
Signed-off-by: Huỳnh Thương <252359928+Huynhthuongg@users.noreply.github.com>
Signed-off-by: Huỳnh Thương <252359928+Huynhthuongg@users.noreply.github.com>
Signed-off-by: Huỳnh Thương <252359928+Huynhthuongg@users.noreply.github.com>
Signed-off-by: Huỳnh Thương <252359928+Huynhthuongg@users.noreply.github.com>
Generated by v0 [v0 Session](https://v0.app/chat/2tqoPgihDyU)
- Updated navigation logic to automatically reset to the default branch after a branch is deleted - Improved user experience by preventing broken or "not found" states when a branch no longer exists [v0 Session](https://v0.app/chat/2tqoPgihDyU)
Generated by v0 [v0 Session](https://v0.app/chat/2tqoPgihDyU) <!-- This is an auto-generated description by cubic. --> --- ## Summary by cubic Initialize the repository with a base project structure and configuration. Sets up build and deployment defaults to unblock local development. <sup>Written for commit b5ae85d. Summary will update on new commits.</sup> <a href="https://cubic.dev/pr/Huynhthuongg/Terkix/pull/7?utm_source=github" target="_blank" rel="noopener noreferrer" data-no-image-dialog="true"><picture><source media="(prefers-color-scheme: dark)" srcset="https://cubic.dev/buttons/review-in-cubic-dark.svg"><source media="(prefers-color-scheme: light)" srcset="https://cubic.dev/buttons/review-in-cubic-light.svg"><img alt="Review in cubic" src="https://cubic.dev/buttons/review-in-cubic-dark.svg"></picture></a> <!-- End of auto-generated description by cubic. -->
- Initialized the repository with a base project structure and directory layout. - Configured build and deployment defaults to enable local development. - Integrated initial UI components and configuration generated via v0. [v0 Session](https://v0.app/chat/2tqoPgihDyU)
### Project Setup - Initialized the repository with a base project structure and directory layout. - Configured build and deployment defaults to enable local development. ### UI & Components - Integrated initial UI components and configuration generated via v0. [v0 Session](https://v0.app/chat/2tqoPgihDyU)
### Project Infrastructure - Initialized the repository structure and directory layout. - Configured build and deployment settings to enable local development. ### UI Foundation - Integrated foundational UI components and styling configuration. [v0 Session](https://v0.app/chat/2tqoPgihDyU)
Co-authored-by: Huỳnh Thương <252359928+Huynhthuongg@users.noreply.github.com>
### Project Infrastructure - Initialized the repository structure and directory layout. - Configured build and deployment settings to enable local development. ### UI & Dashboard - Integrated foundational UI components and global styling configurations. - Refined the Dashboard Overview layout through multiple iterations of styling and layout adjustments to improve visual hierarchy. [v0 Session](https://v0.app/chat/2tqoPgihDyU)
- Implemented automatic reset to the default branch when the current active branch is deleted. [v0 Session](https://v0.app/chat/2tqoPgihDyU)
* Updated branch navigation to automatically reset to the default branch if the currently active branch is deleted. [v0 Session](https://v0.app/chat/2tqoPgihDyU)
Generated by v0 [v0 Session](https://v0.app/chat/2tqoPgihDyU)
Bumps the npm_and_yarn group with 1 update in the / directory: [esbuild](https://github.com/evanw/esbuild). Updates `esbuild` from 0.25.12 to 0.28.1 - [Release notes](https://github.com/evanw/esbuild/releases) - [Changelog](https://github.com/evanw/esbuild/blob/main/CHANGELOG-2025.md) - [Commits](evanw/esbuild@v0.25.12...v0.28.1) Updates `esbuild` from 0.28.0 to 0.28.1 - [Release notes](https://github.com/evanw/esbuild/releases) - [Changelog](https://github.com/evanw/esbuild/blob/main/CHANGELOG-2025.md) - [Commits](evanw/esbuild@v0.25.12...v0.28.1) --- updated-dependencies: - dependency-name: esbuild dependency-version: 0.28.1 dependency-type: direct:development dependency-group: npm_and_yarn - dependency-name: esbuild dependency-version: 0.28.1 dependency-type: indirect dependency-group: npm_and_yarn ... Signed-off-by: dependabot[bot] <support@github.com>
Qodo reviews are paused for this user.Troubleshooting steps vary by plan Learn more → On a Teams plan? Using GitHub Enterprise Server, GitLab Self-Managed, or Bitbucket Data Center? |
|
The latest updates on your projects. Learn more about Vercel for GitHub.
|
|
Important Review skippedAuto reviews are disabled on base/target branches other than the default branch. Please check the settings in the CodeRabbit UI or the ⚙️ Run configurationConfiguration used: Organization UI Review profile: ASSERTIVE Plan: Pro Run ID: You can disable this status message by setting the Use the checkbox below for a quick retry:
✨ Finishing Touches🧪 Generate unit tests (beta)
✨ Simplify code
Thanks for using CodeRabbit! It's free for OSS, and your support helps us grow. If you like it, consider giving us a shout-out. Comment |
|
Kilo Code Review could not run — your account is out of credits. Add credits or switch to a free model to enable reviews on this change. |
There was a problem hiding this comment.
💡 Codex Review
Here are some automated review suggestions for this pull request.
Reviewed commit: d230678477
ℹ️ About Codex in GitHub
Your team has set up Codex to review pull requests in this repo. Reviews are triggered when you
- Open a pull request for review
- Mark a draft as ready
- Comment "@codex review".
If Codex has suggestions, it will comment; otherwise it will react with 👍.
Codex can also answer questions or update the PR. Try commenting "@codex address that feedback".
|
Meticulous was unable to execute a test run for this PR because the most recent commit is associated with multiple PRs. To execute a test run, please try pushing up a new commit that is only associated with this PR. Last updated for commit |
Bumps the npm_and_yarn group with 1 update in the / directory: [esbuild](https://github.com/evanw/esbuild). Updates `esbuild` from 0.25.12 to 0.28.1 - [Release notes](https://github.com/evanw/esbuild/releases) - [Changelog](https://github.com/evanw/esbuild/blob/main/CHANGELOG-2025.md) - [Commits](evanw/esbuild@v0.25.12...v0.28.1) Updates `esbuild` from 0.28.0 to 0.28.1 - [Release notes](https://github.com/evanw/esbuild/releases) - [Changelog](https://github.com/evanw/esbuild/blob/main/CHANGELOG-2025.md) - [Commits](evanw/esbuild@v0.25.12...v0.28.1) --- updated-dependencies: - dependency-name: esbuild dependency-version: 0.28.1 dependency-type: direct:development dependency-group: npm_and_yarn - dependency-name: esbuild dependency-version: 0.28.1 dependency-type: indirect dependency-group: npm_and_yarn ... Signed-off-by: dependabot[bot] <support@github.com> (#37)
Summary by cubic
Stabilizes RKix Terminal OS with a hardened server, safer client storage, and clearer docs. Adds a health endpoint, env-configurable model/port, responsive dashboard, and GitHub Pages/CI workflows.
New Features
/api/health;PORTandGEMINI_MODELenv support; normalized file payloads; fenced-JSON parsing; stricter schema with@google/genai; clearer errors; updated.env.example.src/utils/storage.tsfor defensivelocalStorageusage; integrated inApp.tsxwith safer project selection; tighter, responsiveDashboardOverview.README.mdwith setup and commands;index.htmltitle/description updated;metadata.jsonnow requestsmicrophone.FUNDING.yml; GitHub Actions for Pages and Node/Webpack;CNAMEfor custom domain.rkix-terminal-os(v1.0.5); addedpreviewandtypecheckscripts; moved build tools todevDependencies(vite,@vitejs/plugin-react,@tailwindcss/vite).Migration
.env.exampleto.env, setGEMINI_API_KEY, and optionallyGEMINI_MODELandPORT.npm run devfor local dev;npm run buildthennpm startfor production.CNAMEto your domain.Written for commit 9351aff. Summary will update on new commits.