RXNAAMapper is a tool designed to identify binding sites in protein sequences by leveraging language models trained on biochemical reactions. The tool can capture the signal characterizing amino acid (AA) binding sites using linguistic representations for proteins and their molecular substrates, performing unsupervised binding site prediction from protein sequences and reaction SMILES.
To set up the environment, use the following commands:
conda env create -f conda.yml
conda activate rxn_aa_mapperIn the following we consider the examples provided to show how to use RXNAAMapper.
Create a vocabulary compatible with the enzymatic reaction tokenizer:
create-enzymatic-reaction-vocabulary ./examples/data-samples/biochemical ./examples/token_75K_min_600_max_750_500K.json /tmp/vocabulary.txt "*.csv"The example below shows how to use the LMEnzymaticReactionTokenizer with the vocabulary previously created and the tokenizer:
from rxn_aa_mapper.tokenization import LMEnzymaticReactionTokenizer
tokenizer = LMEnzymaticReactionTokenizer(
vocabulary_file="./examples/vocabulary_token_75K_min_600_max_750_500K.txt",
aa_sequence_tokenizer_filepath="./examples/token_75K_min_600_max_750_500K.json",
aa_sequence_tokenizer_type="generic"
)
tokenizer.tokenize("NC(=O)c1ccc[n+]([C@@H]2O[C@H](COP(=O)(O)OP(=O)(O)OC[C@H]3O[C@@H](n4cnc5c(N)ncnc54)[C@H](O)[C@@H]3O)[C@@H](O)[C@H]2O)c1.O=C([O-])CC(C(=O)[O-])C(O)C(=O)[O-]|AGGVKTVTLIPGDGIGPEISAAVMKIFDAAKAPIQANVRPCVSIEGYKFNEMYLDTVCLNIETACFATIKCSDFTEEICREVAENCKDIK>>O=C([O-])CCC(=O)C(=O)[O-]")We use WandB for logging, if you don't have a mode configured you can simply disable it by setting:
export WANDB_MODE=offlineThe mlm-trainer script can be used to train a model via MTL:
mlm-trainer \
./examples/data-samples/biochemical \ # just a sample train folder
./examples/data-samples/biochemical \ # just a sample validation folder
./examples/vocabulary_token_75K_min_600_max_750_500K.txt \
/tmp/mlm-trainer-log \
./examples/sample-config.json \ # for a more realistic config see ./examples/config.json
"*.csv" \
1 \
./examples/data-samples/organic \ # just a sample train folder
./examples/data-samples/organic \ # just a sample validation folder
./examples/token_75K_min_600_max_750_500K.json \
"generic"Checkpoints will be stored in the /tmp/mlm-trainer-log for later usage in identification of active sites.
These checkpoints can be converted into a HuggingFace model with:
checkpoint-to-hf-model /path/to/model.ckpt /tmp/rxnaamapper-pretrained-model ./examples/vocabulary_token_75K_min_600_max_750_500K.txt ./examples/sample-config.json ./examples/token_75K_min_600_max_750_500K.jsonOnce trained, the RXNAAMapper model can predict reactant atoms and map them to AA sequence locations, indicating potential binding sites:
from rxn_aa_mapper.aa_mapper import RXNAAMapper
config_mapper = {
"vocabulary_file": "./examples/vocabulary_token_75K_min_600_max_750_500K.txt",
"aa_sequence_tokenizer_filepath": "./examples/token_75K_min_600_max_750_500K.json",
"aa_sequence_tokenizer_type": "generic",
"model_path": "/tmp/rxnaamapper-pretrained-model",
"head": 3,
"layers": [11],
"top_k": 1,
}
mapper = RXNAAMapper(config=config_mapper)
mapper.get_reactant_aa_sequence_attention_guided_maps(["NC(=O)c1ccc[n+]([C@@H]2O[C@H](COP(=O)(O)OP(=O)(O)OC[C@H]3O[C@@H](n4cnc5c(N)ncnc54)[C@H](O)[C@@H]3O)[C@@H](O)[C@H]2O)c1.O=C([O-])CC(C(=O)[O-])C(O)C(=O)[O-]|AGGVKTVTLIPGDGIGPEISAAVMKIFDAAKAPIQANVRPCVSIEGYKFNEMYLDTVCLNIETACFATIKCSDFTEEICREVAENCKDIK>>O=C([O-])CCC(=O)C(=O)[O-]"])NOTE: The model path should contain both the model binary file and the config.json. These files are generated from the model trained and converted to a HuggingFace model using the script provided in the previous section.
@article{teukam2024language,
title={Language models can identify enzymatic binding sites in protein sequences},
author={Teukam, Yves Gaetan Nana and Dassi, Lo{\"\i}c Kwate and Manica, Matteo and Probst, Daniel and Schwaller, Philippe and Laino, Teodoro},
journal={Computational and Structural Biotechnology Journal},
volume={23},
pages={1929--1937},
year={2024},
publisher={Elsevier}
}